TSPAN12 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. They mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN12 plays a central role in retinal vascularization by regulating norrin signal transduction. TSPAN12 acts in concert with norrin to promote FZD4 multimerization and subsequent activation of FZD4, leading to promote accumulation of beta-catenin and stimulate LEF/TCF-mediated transcriptional programs. Defects in TSPAN12 are the cause of vitreoretinopathy exudative type 5, a disorder of the retinal vasculature characterized by an abrupt cessation of growth of peripheral capillaries, leading to an avascular peripheral retina.
TSPAN12 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91298
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide directed towards the middle region of human TSPAN12. Peptide sequence: DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for TSPAN12 Antibody - BSA Free
Western Blot: TSPAN12 Antibody [NBP1-91298]
Western Blot: TSPAN12 Antibody [NBP1-91298] - Host: Rabbit. Target Name: TSPAN12. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/mlWestern Blot: TSPAN12 Antibody [NBP1-91298]
Western Blot: TSPAN12 Antibody [NBP1-91298] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.Applications for TSPAN12 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TSPAN12
Additional TSPAN12 Products
Product Documents for TSPAN12 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TSPAN12 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for TSPAN12 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TSPAN12 Antibody - BSA Free and earn rewards!
Have you used TSPAN12 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...