TSPAN6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59047

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to TSPAN6(tetraspanin 6) The peptide sequence was selected from the N terminal of TSPAN6. Peptide sequence VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TSPAN6 Antibody - BSA Free

Western Blot: TSPAN6 Antibody [NBP1-59047]

Western Blot: TSPAN6 Antibody [NBP1-59047]

Western Blot: Tetraspanin-6 Antibody [NBP1-59047] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Applications for TSPAN6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN6

TSPAN6 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2. The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2. The use of alternate polyadenylation sites has been found for this gene.

Long Name

Tetraspanin 6

Alternate Names

T245, TM4-D, TM4SF6

Gene Symbol

TSPAN6

UniProt

Additional TSPAN6 Products

Product Documents for TSPAN6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TSPAN6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TSPAN6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSPAN6 Antibody - BSA Free and earn rewards!

Have you used TSPAN6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...