TSPAN6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59047

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TSPAN6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TSPAN6(tetraspanin 6) The peptide sequence was selected from the N terminal of TSPAN6. Peptide sequence VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TSPAN6 Antibody - BSA Free

Western Blot: TSPAN6 Antibody [NBP1-59047]

Western Blot: TSPAN6 Antibody [NBP1-59047]

Western Blot: Tetraspanin-6 Antibody [NBP1-59047] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Applications for TSPAN6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN6

TSPAN6 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2. The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2. The use of alternate polyadenylation sites has been found for this gene.

Long Name

Tetraspanin 6

Alternate Names

T245, TM4-D, TM4SF6

Gene Symbol

TSPAN6

UniProt

O43657 (Human)

Additional TSPAN6 Products

Product Documents for TSPAN6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TSPAN6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TSPAN6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSPAN6 Antibody - BSA Free and earn rewards!

Have you used TSPAN6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies