TSPAN8/TM4SF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17777

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TSPAN8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TSPAN8/TM4SF3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TSPAN8/TM4SF3 Antibody [NBP3-17777]

Immunocytochemistry/ Immunofluorescence: TSPAN8/TM4SF3 Antibody [NBP3-17777]

Immunocytochemistry/Immunofluorescence: TSPAN8/TM4SF3 Antibody [NBP3-17777] - Staining of human cell line OE19 shows localization to vesicles.

Applications for TSPAN8/TM4SF3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN8

TM4SF3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TM4SF3 is known to complex with integrins. Its gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for TM4SF3 gene.

Long Name

Tetraspanin 8/Transmembrane 4 Superfamily, Member 3

Alternate Names

CO-029, TM4SF3

Gene Symbol

TSPAN8

Additional TSPAN8 Products

Product Documents for TSPAN8/TM4SF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TSPAN8/TM4SF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Integrins and Associated Molecules

Customer Reviews for TSPAN8/TM4SF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSPAN8/TM4SF3 Antibody - BSA Free and earn rewards!

Have you used TSPAN8/TM4SF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies