TSTA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59130

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TSTA3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TSTA3(tissue specific transplantation antigen P35B) The peptide sequence was selected from the N terminal of TSTA3. Peptide sequence MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TSTA3 Antibody - BSA Free

Western Blot: TSTA3 Antibody [NBP1-59130]

Western Blot: TSTA3 Antibody [NBP1-59130]

Western Blot: TSTA3 Antibody [NBP1-59130] - Hela, Antibody Dilution: 1.0 ug/ml TSTA3 is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Immunohistochemistry-Paraffin: TSTA3 Antibody [NBP1-59130] -

Immunohistochemistry-Paraffin: TSTA3 Antibody [NBP1-59130] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution P
Western Blot: TSTA3 Antibody [NBP1-59130]

Western Blot: TSTA3 Antibody [NBP1-59130]

Western Blot: TSTA3 Antibody [NBP1-59130] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: TSTA3 Antibody [NBP1-59130]

Western Blot: TSTA3 Antibody [NBP1-59130]

Western Blot: TSTA3 Antibody [NBP1-59130] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml TSTA3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Applications for TSTA3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSTA3

Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.

Alternate Names

EC 1.1.1.271, FX, GDP-4-keto-6-deoxy-D-mannose epimerase-reductase, GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase, GDP-L-fucose synthase, P35B, Protein FX, Red cell NADP(H)-binding protein, SDR4E13-5 epimerase/4-reductase, short chain dehydrogenase/reductase family 4E, member 1, Short-chain dehydrogenase/reductase family 4E member 1, tissue specific transplantation antigen 3, tissue specific transplantation antigen P35B, Tissue-specific transplantation antigen-3

Gene Symbol

GFUS

UniProt

Q13630 (Human)

Additional TSTA3 Products

Product Documents for TSTA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TSTA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TSTA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSTA3 Antibody - BSA Free and earn rewards!

Have you used TSTA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies