TUBA3D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84315

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TUBA3D Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TUBA3D. Peptide sequence: DGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TUBA3D Antibody - BSA Free

Western Blot: TUBA3D Antibody [NBP2-84315]

Western Blot: TUBA3D Antibody [NBP2-84315]

Western Blot: TUBA3D Antibody [NBP2-84315] - Host: Rabbit. Target Name: TUBA3C. Sample Tissue: DLD1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for TUBA3D Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TUBA3D

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site onthe beta chain and one at a non-exchangeable site on the alpha-chain

Long Name

Tubulin alpha-3D chain

Alternate Names

Alpha-tubulin 2, Alpha-tubulin 3C/D, alpha-tubulin isotype H2-alpha, H2-ALPHA, TUBA2, TUBA3C, Tubulin alpha-2 chain, tubulin alpha-3C/D chain, tubulin, alpha 3d

Gene Symbol

TUBA3D

Additional TUBA3D Products

Product Documents for TUBA3D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TUBA3D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TUBA3D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TUBA3D Antibody - BSA Free and earn rewards!

Have you used TUBA3D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies