TUSC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37850

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TUSC3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for Anti-TUSC3 antibody is: synthetic peptide directed towards the N-terminal region of Human TUSC3.. Peptide sequence: ARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TUSC3 Antibody - BSA Free

Western Blot: TUSC3 Antibody [NBP2-37850]

Western Blot: TUSC3 Antibody [NBP2-37850]

Western Blot: TUSC3 Antibody [NBP2-37850] - U937 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: TUSC3 Antibody [NBP2-37850]

Western Blot: TUSC3 Antibody [NBP2-37850]

Western Blot: TUSC3 Antibody [NBP2-37850] - Host: Rabbit. Target Name: TUSC3. Sample Type: U937 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for TUSC3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TUSC3

TUSC3 is a candidate tumor suppressor gene. It is located within a homozygously deleted region of a metastatic prostate cancer. The gene is expressed in most nonlymphoid human tissues including prostate, lung, liver, and colon. Expression was also detected in many epithelial tumor cell lines. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Alternate Names

D8S1992, M33, N33MRT7MGC13453, oligosaccharyltransferase 3 homolog A, OST3A, Protein N33, Putative prostate cancer tumor suppressor, tumor suppressor candidate 3

Gene Symbol

TUSC3

UniProt

Q13454 (Human)

Additional TUSC3 Products

Product Documents for TUSC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TUSC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TUSC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TUSC3 Antibody - BSA Free and earn rewards!

Have you used TUSC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies