TUT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86030

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TUT1. Peptide sequence: EGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPAD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TUT1 Antibody - BSA Free

Western Blot: TUT1 Antibody [NBP2-86030]

Western Blot: TUT1 Antibody [NBP2-86030]

Western Blot: TUT1 Antibody [NBP2-86030] - Host: Rabbit. Target: TUT1. Positive control (+): MCF7 Cell Lysate (N10). Negative control (-): A549 Cell Lysate (N03). Antibody concentration: 3ug/ml
Western Blot: TUT1 Antibody [NBP2-86030]

Western Blot: TUT1 Antibody [NBP2-86030]

Western Blot: TUT1 Antibody [NBP2-86030] - Host: Rabbit. Target Name: TUT1. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: TUT1 Antibody [NBP2-86030]

Western Blot: TUT1 Antibody [NBP2-86030]

Western Blot: TUT1 Antibody [NBP2-86030] - WB Suggested Anti-TUT1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Transfected 293T

Applications for TUT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TUT1

The TUT1 gene encodes a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A)polymerase. The encoded enzyme specifically adds and removes nucleotides from the 3' end of small nuclear RNAsand select mRNAs and may f

Alternate Names

EC 2.7.7.19, EC 2.7.7.52, FLJ21850, FLJ22267, FLJ22347, MGC131987, MGC149809, nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpharegulated-poly(A) polymerase, nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase, PAP-associated domain-containing 2, PAPD2, poly(A) polymerase associated domain containing 2, RBM21, RNA binding motif protein 21, RNA uridylyltransferase, RNA-binding motif protein 21, RNA-binding protein 21, speckle targeted PIP5K1A-regulated poly(A) polymerase, STARPAP, Star-PAP, terminal uridylyl transferase 1, U6 snRNA-specific, TUTase, U6 snRNA-specific terminal uridylyltransferase 1, U6 TUTase, U6-TUTase

Gene Symbol

TUT1

Additional TUT1 Products

Product Documents for TUT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TUT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TUT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TUT1 Antibody - BSA Free and earn rewards!

Have you used TUT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...