Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60025

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to TPST2(tyrosylprotein sulfotransferase 2) The peptide sequence was selected from the middle region of TPST2. Peptide sequence KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Western Blot: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody [NBP1-60025]

Western Blot: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody [NBP1-60025]

Western Blot: TPST2 Antibody [NBP1-60025] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tyrosylprotein Sulfotransferase 2/TPST2

TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene.

Alternate Names

Tyrosylprotein Sulfotransferase 2

Entrez Gene IDs

8459 (Human)

Gene Symbol

TPST2

UniProt

Additional Tyrosylprotein Sulfotransferase 2/TPST2 Products

Product Documents for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free and earn rewards!

Have you used Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: What is the lower limit of detection for TPST2 in Western blot?

    A: We generally do not test the limits of detection for our antibodies as this time. I apologize for the inconvenience.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...