U2AF1L4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88528

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human U2AF1L4. Peptide sequence: KIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for U2AF1L4 Antibody - BSA Free

Western Blot: U2AF1L4 Antibody [NBP2-88528]

Western Blot: U2AF1L4 Antibody [NBP2-88528]

Western Blot: U2AF1L4 Antibody [NBP2-88528] - Host: Rabbit. Target Name: U2AF1L4. Sample Type: HepG2 Whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for U2AF1L4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: U2AF1L4

RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutiveand enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required foraccurate 3'-splice site selection. Acts by enhancing the binding of U2AF2 to weak pyrimidine tracts. Also participatesin the regulation of alternative pre-mRNA splicing. Activates exon 5 skipping of PTPRC during T cell activation; anevent reversed by GFI1. Binds to RNA at the AG dinucleotide at the 3'-splice site

Alternate Names

FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA auxiliary factor 1-like protein 4, U2(RNU2) small nuclear RNA auxiliary factor 1-like 3, U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3, U2AF1L3, U2AF1L3V1, U2AF1-like protein 3, U2AF1RS3, U2AF1-RS3, U2af26

Gene Symbol

U2AF1L4

Additional U2AF1L4 Products

Product Documents for U2AF1L4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for U2AF1L4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for U2AF1L4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review U2AF1L4 Antibody - BSA Free and earn rewards!

Have you used U2AF1L4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...