UAF1/WDR48 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86033

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human UAF1/WDR48. Peptide sequence: YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for UAF1/WDR48 Antibody - BSA Free

Western Blot: UAF1/WDR48 Antibody [NBP2-86033]

Western Blot: UAF1/WDR48 Antibody [NBP2-86033]

Western Blot: UAF1/WDR48 Antibody [NBP2-86033] - Host: Rabbit. Target Name: WDR48. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for UAF1/WDR48 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UAF1

Regulator of deubiquitinating complexes. Acts as a strong activator of USP1 by enhancing the USP1-mediateddeubiquitination of FANCD2; USP1 being almost inactive by itself. Also activates deubiquitinating activity ofcomplexes containing USP12 and USP46, respectively. Activates deubiquitination by increasing the catalytic turnoverwithout increasing the affinity of deubiquitinating enzymes for the substrate. In case of infection by Herpesvirussaimiri, may play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes.Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein(TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptorTCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP. In case of infection bypapillomavirus HPV11, promotes the maintenance of the viral genome via its interaction with HPV11 helicase E1

Long Name

USP1-associated Factor 1

Alternate Names

P80, WDR48

Gene Symbol

WDR48

Additional UAF1 Products

Product Documents for UAF1/WDR48 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UAF1/WDR48 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for UAF1/WDR48 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UAF1/WDR48 Antibody - BSA Free and earn rewards!

Have you used UAF1/WDR48 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...