UbcH2/UBE2H Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10562

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse UbcH2/UBE2H (NP_033485). Peptide sequence PSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for UbcH2/UBE2H Antibody - BSA Free

Western Blot: UbcH2/UBE2H Antibody [NBP3-10562]

Western Blot: UbcH2/UBE2H Antibody [NBP3-10562]

Western Blot: UbcH2/UBE2H Antibody [NBP3-10562] - Western blot analysis of UbcH2/UBE2H in Mouse Testis lysates. Antibody dilution at 1.0ug/ml

Applications for UbcH2/UBE2H Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UbcH2/UBE2H

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.

Alternate Names

E2-14K, E2-20K, UBC8, UBE2H

Gene Symbol

UBE2H

Additional UbcH2/UBE2H Products

Product Documents for UbcH2/UBE2H Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UbcH2/UBE2H Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UbcH2/UBE2H Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UbcH2/UBE2H Antibody - BSA Free and earn rewards!

Have you used UbcH2/UBE2H Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway Ubiquitination Cascade Pathway Thumbnail