UbcH5a/UBE2D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55033

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to UBE2D1(ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2D1. Peptide sequence SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UbcH5a/UBE2D1 Antibody - BSA Free

Western Blot: UbcH5a/UBE2D1 Antibody [NBP1-55033]

Western Blot: UbcH5a/UBE2D1 Antibody [NBP1-55033]

Western Blot: UbcH5a/UBE2D1 Antibody [NBP1-55033] - Jurkat cell lysate, concentration 1.25ug/ml.
Western Blot: UbcH5a/UBE2D1 Antibody [NBP1-55033]

Western Blot: UbcH5a/UBE2D1 Antibody [NBP1-55033]

Western Blot: UbcH5a/UBE2D1 Antibody [NBP1-55033] - Lanes: 1 : 40 ng HIS-UBE2D1 protein2: 40 ng HIS-UBE2D2 protein3: 40 ng HIS-UBE2D3 protein4: 40 ng HIS-UBE2D4 protein5: 40 ng HIS-UBE2E1 protein6: 40 ng HIS-UBE2E2 protein7: 40 ng HIS-UBE2E3 protein8: 40 ng HIS-UBE2K protein9: 40 ng HIS-UBE2L3 protein10: 40 ng HIS-UBE2N protein11 : 40 ng HIS-UBE2V1 protein12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 50,000.

Applications for UbcH5a/UBE2D1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UbcH5a/UBE2D1

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.

Alternate Names

E2(17)KB1, UBC4/5, UBC5A, UBE2D1

Gene Symbol

UBE2D1

UniProt

Additional UbcH5a/UBE2D1 Products

Product Documents for UbcH5a/UBE2D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UbcH5a/UBE2D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UbcH5a/UBE2D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UbcH5a/UBE2D1 Antibody - BSA Free and earn rewards!

Have you used UbcH5a/UBE2D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway
Ubiquitination Cascade Pathway Thumbnail