UbcH5c/UBE2D3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55276

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UbcH5c/UBE2D3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D3. Peptide sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UbcH5c/UBE2D3 Antibody - BSA Free

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - MCF7, Antibody Dilution: 1.0 ug/ml UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Jurkat, Antibody Dilution: 1.0 ug/ml UBE2D3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276]

Western Blot: UbcH5c/UBE2D3 Antibody [NBP1-55276] - Lanes: 1 : 40 ng HIS-UBE2D1 protein2: 40 ng HIS-UBE2D2 protein3: 40 ng HIS-UBE2D3 protein4: 40 ng HIS-UBE2D4 protein5: 40 ng HIS-UBE2E1 protein6: 40 ng HIS-UBE2E2 protein7: 40 ng HIS-UBE2E3 protein8: 40 ng HIS-UBE2K protein9: 40 ng HIS-UBE2L3 protein10: 40 ng HIS-UBE2N protein11 : 40 ng HIS-UBE2V1 protein12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 50,000.

Applications for UbcH5c/UBE2D3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UbcH5c/UBE2D3

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.

Alternate Names

UBC5C, UBE2D3

Gene Symbol

UBE2D3

UniProt

P61077 (Human)

Additional UbcH5c/UBE2D3 Products

Product Documents for UbcH5c/UBE2D3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UbcH5c/UBE2D3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for UbcH5c/UBE2D3 Antibody - BSA Free

Customer Reviews for UbcH5c/UBE2D3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UbcH5c/UBE2D3 Antibody - BSA Free and earn rewards!

Have you used UbcH5c/UBE2D3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Ubiquitination Cascade Pathway Ubiquitination Cascade Pathway Thumbnail