UBE2K/E2-25K Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54914

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UBE2K/E2-25K Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to UBE2K/E2-25K The peptide sequence was selected from the N terminal of UBE2K/E2-25K. Peptide sequence MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UBE2K/E2-25K Antibody - BSA Free

Western Blot: UBE2K/E2-25K Antibody [NBP1-54914]

Western Blot: UBE2K/E2-25K Antibody [NBP1-54914]

Western Blot: UBE2K/E2-25K Antibody [NBP1-54914] - Jurkat cell lysate, concentration 5.0ug/ml.

Applications for UBE2K/E2-25K Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBE2K/E2-25K

HIP2 belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.The protein encoded by this gene belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.

Long Name

Ubiquitin-conjugating Enzyme E2

Alternate Names

E2-25K, E225K, Hip2, HYPG, LIG, UbcH1, UBE2K, UBE2K-25K

Gene Symbol

UBE2K

UniProt

P61086 (Human)

Additional UBE2K/E2-25K Products

Product Documents for UBE2K/E2-25K Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UBE2K/E2-25K Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBE2K/E2-25K Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBE2K/E2-25K Antibody - BSA Free and earn rewards!

Have you used UBE2K/E2-25K Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Ubiquitination Cascade Pathway Ubiquitination Cascade Pathway Thumbnail