UBE2Q2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82369

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all UBE2Q2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UBE2Q2. Peptide sequence: EDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for UBE2Q2 Antibody - BSA Free

Western Blot: UBE2Q2 Antibody [NBP2-82369]

Western Blot: UBE2Q2 Antibody [NBP2-82369]

Western Blot: UBE2Q2 Antibody [NBP2-82369] - WB Suggested Anti-UBE2Q2 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Heart

Applications for UBE2Q2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBE2Q2

UBE2Q2 catalyzes the covalent attachment of ubiquitin to other proteins (Probable)

Long Name

Ubiquitin-conjugating Enzyme E2Q 2

Alternate Names

DKFZp762C143, EC 6.3.2.19, LOC92912, Ubiquitin carrier protein Q2, ubiquitin-conjugating enzyme E2 Q2, ubiquitin-conjugating enzyme E2Q (putative) 2, ubiquitin-conjugating enzyme E2Q family member 2, Ubiquitin-protein ligase Q2

Gene Symbol

UBE2Q2

Additional UBE2Q2 Products

Product Documents for UBE2Q2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBE2Q2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBE2Q2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBE2Q2 Antibody - BSA Free and earn rewards!

Have you used UBE2Q2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Ubiquitination Cascade Pathway Ubiquitination Cascade Pathway Thumbnail