UBIAD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86037

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human UBIAD1. Peptide sequence: PLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for UBIAD1 Antibody - BSA Free

Western Blot: UBIAD1 Antibody [NBP2-86037]

Western Blot: UBIAD1 Antibody [NBP2-86037]

Western Blot: UBIAD1 Antibody [NBP2-86037] - Host: Rabbit. Target Name: UBIAD1. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for UBIAD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBIAD1

UBIAD1 is a novel gene designated TERE1 that has a significant effect on the growth regulation in bladder cancer. The TERE1 gene maps to a chromosome locus that has been identified, in loss of heterozygosity studies, as a site of a putative tumor suppressor gene or genes for multiple tumor types including prostate carcinoma. Data suggest that TERE1 may be significant in prostate cancer growth regulation, and the down regulation or absence of TERE1 may be an important component of the phenotype of advanced disease. Data also suggest a potential role for this gene product in the progression of bladder cancer.

Alternate Names

EC 2.5.1.-, RP4-796F18.1, SCCD, Schnyder crystalline corneal dystrophy, TERE1transitional epithelia response protein, Transitional epithelial response protein 1, UbiA prenyltransferase domain containing 1, ubiA prenyltransferase domain-containing protein 1

Gene Symbol

UBIAD1

Additional UBIAD1 Products

Product Documents for UBIAD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBIAD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBIAD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBIAD1 Antibody - BSA Free and earn rewards!

Have you used UBIAD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...