Ubiquitin Specific Peptidase 8 (USP8), also known as Ubiquitin Isopeptidase Y (UBPY), is a widely expressed deubiquitinating enzyme belonging to the peptidase C19 family. It has a predicted molecular weight of 127.5 kDa. Human USP8 is 1118 amino acids (aa) in length and shares 84% aa sequence identity with the mouse and rat orthologs. It contains an N-terminal MIT domain (aa 33-116) that mediates endosomal localization, CHMP-binding, and maintenance of ESCRT-0. USP8 also has a rhodanese domain (aa 181-319) that binds NRDP1 Ubiquitin ligase (E3), a SH3 domain binding sequence (aa 405-413), and a C-terminal catalytic domain (aa 734-1110). USP8 is a growth-regulated enzyme that controls the internalization and endocytic trafficking of cell surface receptors. Some receptors are targeted for internalization and degradation by ubiquitination. USP8 has been shown to disrupt the down-regulation of multiple receptors, including EGF R/ErbB1, ErbB2/Her2, and Smoothened, via their deubiquitination. Conversely, USP8 appears to have the opposite effect on the trafficking of CXCR4, PAR2, and the delta-opioid receptor. Depletion or catalytic inactivation of USP8 stabilized their expression. It is thought that deubiquitination of these receptors down-stream of the sorting endosome commits them to lysosomal degradation. USP8 can be phosphorylated at Ser680 allowing for 14-3-3-epsilon binding, which subsequently inhibits USP8 activity. Additionally, USP8 undergoes tyrosine phosphorylation at its N-terminus following EGF activation of the EGF R/ErbB1 / ErbB2/Her2 receptor complex.
UBPY/USP8 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-55627
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for UBPY/USP8 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: UBPY/USP8 Antibody [NBP2-55627]
Immunocytochemistry/Immunofluorescence: UBPY/USP8 Antibody [NBP2-55627] - Staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627]
Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627] - Staining of human colon shows moderate membranous and cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627]
Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts.Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627]
Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627] - Staining of human fallopian tube shows moderate positivity in apical membrane in glandular cells.Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627]
Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627]
Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627] - Staining of human placenta shows moderate cytoplasmic and membranous positivity in trophoblastic cells.Applications for UBPY/USP8 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: USP8
Long Name
Ubiquitin Specific Protease 8
Alternate Names
UBPY
Gene Symbol
USP8
Additional USP8 Products
Product Documents for UBPY/USP8 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for UBPY/USP8 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for UBPY/USP8 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review UBPY/USP8 Antibody - BSA Free and earn rewards!
Have you used UBPY/USP8 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...