UGP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55519

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UGP2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to UGP2(UDP-glucose pyrophosphorylase 2) The peptide sequence was selected from the N terminal of UGP2. Peptide sequence TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UGP2 Antibody - BSA Free

Western Blot: UGP2 Antibody [NBP1-55519]

Western Blot: UGP2 Antibody [NBP1-55519]

Western Blot: UGP2 Antibody [NBP1-55519] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for UGP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UGP2

UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

EC 2.7.7.9, pHC379, UDPG, UDP-glucose diphosphorylase, UDP-glucose pyrophosphorylase, UDP-glucose pyrophosphorylase 2, UDPGP, UDPGP2, UGP1, UGPase, UGPase 2, UGPP2, uridyl diphosphate glucose pyrophosphorylase 2, UTP-glucose-1-phosphate uridyltransferase, UTP--glucose-1-phosphate uridylyltransferase, UTP--glucose-1-phosphate uridylyltransferase 2

Gene Symbol

UGP2

UniProt

Q16851-2 (Human)

Additional UGP2 Products

Product Documents for UGP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UGP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UGP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UGP2 Antibody - BSA Free and earn rewards!

Have you used UGP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies