UGT2A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83737

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UGT2A1. Peptide sequence: QIPQKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for UGT2A1 Antibody - BSA Free

Western Blot: UGT2A1 Antibody [NBP2-83737]

Western Blot: UGT2A1 Antibody [NBP2-83737]

Western Blot: UGT2A1 Antibody [NBP2-83737] - Host: Rabbit. Target Name: UGT2A1. Sample Tissue: Human Ovary Tumor. Antibody Dilution: 1.0ug/ml

Applications for UGT2A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UGT2A1

The protein encoded by this gene belongs to the UDP-glycosyltransferase family. Members of this protein family play a role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. The encoded enzyme is expressed in the olfactory neuroepithelium, which lines the posterior nasal cavity and is exposed to a wide range of odorants and airborne toxic compounds. Hence, this protein has been suggested to be involved in clearing lipophilic odorant molecules from the sensory epithelium. This gene shares exon structure with the UDP glucuronosyltransferase 2A2 family member, which encodes N-terminally distinct isoforms. Polymorphisms in this gene may be associated with the loss of taste and smell that is reported by some individuals during SARS-CoV-2 infection.

Alternate Names

UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus, UDP glycosyltransferase 2 family, polypeptide A1, UDP-glucuronosyltransferase 2A1, UDPGT2A1, uridine diphosphate glycosyltransferase 2 family, member A1

Gene Symbol

UGT2A1

Additional UGT2A1 Products

Product Documents for UGT2A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UGT2A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UGT2A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UGT2A1 Antibody - BSA Free and earn rewards!

Have you used UGT2A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...