ULBP-3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31866

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ULBP-3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ULBP-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866]

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866]

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] - Staining of human testis shows moderate positivity in a subset of cells in seminiferous ducts.
Immunocytochemistry/ Immunofluorescence: ULBP-3 Antibody [NBP2-31866]

Immunocytochemistry/ Immunofluorescence: ULBP-3 Antibody [NBP2-31866]

Immunocytochemistry/Immunofluorescence: ULBP-3 Antibody [NBP2-31866] - Staining ULBP-3 in methanol-fixed, Jurkat cells using anti-ULBP-3 antibody. Image submitted by a verified customer review.
ULBP-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] -

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
ULBP-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] -

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] - Staining of human liver shows no positivity in hepatocytes as expected.
ULBP-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] -

Immunohistochemistry-Paraffin: ULBP-3 Antibody [NBP2-31866] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for ULBP-3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Validated from a verified customer review

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 4 using NBP2-31866 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ULBP-3

Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP2. ULBPs activate multiple signalingpathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands toNKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transductionpathway. Has lower affinity for NKG2D compared to ULBP1 and ULBP2 and induces weaker signaling responses than doesULBP2 or ULBP1

Long Name

UL16 Binding Protein-3

Alternate Names

ULBP3

Gene Symbol

ULBP3

UniProt

Q9BZM4

Additional ULBP-3 Products

Product Documents for ULBP-3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ULBP-3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ULBP-3 Antibody - BSA Free

Customer Reviews for ULBP-3 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ULBP-3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: Cytospin of cell culture cells
    Species: Human
    Verified Customer | Posted 08/07/2015
    Jurkat cells stained with ULBP3, detected with secondary AlexaFluor 568
    ULBP-3 Antibody - BSA Free NBP2-31866

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ULBP-3 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Our customer was interested in the ULBP antibodies with the Cat No. NBP1-80856 and NBP2-31866. However, it didn’t show clearly whether the NBP2-31866 was tested in IHC-P. In the datasheet, it just read immunochemistry. But there was a figure of IHC-P in the datasheet.

    A: In answer to your question, NBP2-31866 was tested on paraffin-embedded tissues. I am very sorry that this was not detailed on our datasheet. I have requested that this change be made, and it should be reflected on the website in 24-48 hours.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies