UPF3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55254

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQR

Reactivity Notes

Mouse 88%, Rat 88%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UPF3A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: UPF3A Antibody [NBP2-55254]

Immunocytochemistry/ Immunofluorescence: UPF3A Antibody [NBP2-55254]

Immunocytochemistry/Immunofluorescence: UPF3A Antibody [NBP2-55254] - Staining of human cell line Hep G2 shows localization to nucleus & vesicles.

Applications for UPF3A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UPF3A

UPF3A encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome 13. Two splice variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

HUPF3A, Nonsense mRNA reducing factor 3A, regulator of nonsense transcripts 3A, RENT3AUp-frameshift suppressor 3 homolog A, UPF3 regulator of nonsense transcripts homolog A (yeast), UPF3hUpf3

Gene Symbol

UPF3A

Additional UPF3A Products

Product Documents for UPF3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UPF3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UPF3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UPF3A Antibody - BSA Free and earn rewards!

Have you used UPF3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...