USP43 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-88562
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Western Blot
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP43. Peptide sequence: KSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNER The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for USP43 Antibody - BSA Free
Western Blot: USP43 Antibody [NBP2-88562]
Western Blot: USP43 Antibody [NBP2-88562] - Host: Rabbit. Target Name: USP43. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/mlWestern Blot: USP43 Antibody - BSA Free [NBP2-88562] -
USP43 regulates ZEB1 expression through ubiquitination. A. Verifying the correlation between USP43 and ZEB1 mRNA in 50 colon cancer specimens. B. The correlation between USP43 and ZEB1 protein expression was calculated In 50 pairs of colon cancer specimens. C-D. Western blot and qRT-PCR analysis the relationships between USP43 and ZEB1. E. ZEB1 protein expression analysis with CQ and MG132 treatments. F. Co-precipitation analysis of USP43 and ZEB1 protein in SW480 cell G. co-localization of immunofluorescence analysis of USP43 and ZEB1 in SW480 and DLD1 cell. H. Co-precipitation of USP43 and ZEB1 in the 293T cell. I. Ubiquitination testing of USP43 in DLD1 cell line. J. Ubiquitination testing of USP43 in SW480 cell line. K-L. Cycloheximide (protein degradation rate) analysis shows that USP43 can inhibit ZEB1 protein degradation. *P<0.05, **P<0.01, ***P<0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33391437), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: USP43 Antibody - BSA Free [NBP2-88562] -
Detection of USP43 expression in colorectal cancer. A. The expression level of USP43 was verified in GEPIA database (http://gepia.cancer-pku.cn/). B. qRT-PCR analysis of USP43 expression level in colorectal cancer tissues and normal tissues. C. The sample distribution analysis of the high expression in tumor tissue and high expression in adjacent tissues among 50 pairs of specimens. D. Detection of USP43 expression levels in colorectal cancer tissues and normal tissues with IHC. E. IHC score statistics of the USP43 expression levels in 50 colorectal cancer tissues and normal tissues. F. Western blot analysis of the USP43 expression level in colorectal cancer tissues and normal tissues. *P<0.05, ***P<0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33391437), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for USP43 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Application Notes
Use in IHC reported in scientific literature (PMID:33391437)
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: USP43
Long Name
Ubiquitin carboxyl-terminal hydrolase 43
Alternate Names
Deubiquitinating enzyme 43, EC 3.1.2.15, EC 3.4.19.12, FLJ30626, ubiquitin carboxyl-terminal hydrolase 43, ubiquitin specific peptidase 43, ubiquitin specific protease 43, ubiquitin thioesterase 43, Ubiquitin thiolesterase 43, Ubiquitin-specific-processing protease 43
Gene Symbol
USP43
Additional USP43 Products
Product Documents for USP43 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for USP43 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for USP43 Antibody - BSA Free
Customer Reviews for USP43 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review USP43 Antibody - BSA Free and earn rewards!
Have you used USP43 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...