USP43 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88562

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Western Blot

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP43. Peptide sequence: KSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNER The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for USP43 Antibody - BSA Free

Western Blot: USP43 Antibody [NBP2-88562]

Western Blot: USP43 Antibody [NBP2-88562]

Western Blot: USP43 Antibody [NBP2-88562] - Host: Rabbit. Target Name: USP43. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml
USP43 Antibody - BSA Free

Western Blot: USP43 Antibody - BSA Free [NBP2-88562] -

USP43 regulates ZEB1 expression through ubiquitination. A. Verifying the correlation between USP43 and ZEB1 mRNA in 50 colon cancer specimens. B. The correlation between USP43 and ZEB1 protein expression was calculated In 50 pairs of colon cancer specimens. C-D. Western blot and qRT-PCR analysis the relationships between USP43 and ZEB1. E. ZEB1 protein expression analysis with CQ and MG132 treatments. F. Co-precipitation analysis of USP43 and ZEB1 protein in SW480 cell G. co-localization of immunofluorescence analysis of USP43 and ZEB1 in SW480 and DLD1 cell. H. Co-precipitation of USP43 and ZEB1 in the 293T cell. I. Ubiquitination testing of USP43 in DLD1 cell line. J. Ubiquitination testing of USP43 in SW480 cell line. K-L. Cycloheximide (protein degradation rate) analysis shows that USP43 can inhibit ZEB1 protein degradation. *P<0.05, **P<0.01, ***P<0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33391437), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
USP43 Antibody - BSA Free

Western Blot: USP43 Antibody - BSA Free [NBP2-88562] -

Detection of USP43 expression in colorectal cancer. A. The expression level of USP43 was verified in GEPIA database (http://gepia.cancer-pku.cn/). B. qRT-PCR analysis of USP43 expression level in colorectal cancer tissues and normal tissues. C. The sample distribution analysis of the high expression in tumor tissue and high expression in adjacent tissues among 50 pairs of specimens. D. Detection of USP43 expression levels in colorectal cancer tissues and normal tissues with IHC. E. IHC score statistics of the USP43 expression levels in 50 colorectal cancer tissues and normal tissues. F. Western blot analysis of the USP43 expression level in colorectal cancer tissues and normal tissues. *P<0.05, ***P<0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33391437), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for USP43 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Use in IHC reported in scientific literature (PMID:33391437)

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: USP43

USP43 - ubiquitin specific protease 43

Long Name

Ubiquitin carboxyl-terminal hydrolase 43

Alternate Names

Deubiquitinating enzyme 43, EC 3.1.2.15, EC 3.4.19.12, FLJ30626, ubiquitin carboxyl-terminal hydrolase 43, ubiquitin specific peptidase 43, ubiquitin specific protease 43, ubiquitin thioesterase 43, Ubiquitin thiolesterase 43, Ubiquitin-specific-processing protease 43

Gene Symbol

USP43

Additional USP43 Products

Product Documents for USP43 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for USP43 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for USP43 Antibody - BSA Free

Customer Reviews for USP43 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review USP43 Antibody - BSA Free and earn rewards!

Have you used USP43 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...