VAMP-1 Antibody (5F3) - Azide and BSA Free

Novus Biologicals | Catalog # H00006843-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Lambda Clone # 5F3

Format

Azide and BSA Free
View all VAMP-1 Primary Antibodies »

Product Specifications

Immunogen

VAMP1 (NP_055046, 28 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK

Specificity

VAMP1 - vesicle-associated membrane protein 1 (synaptobrevin 1) (5F3)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Lambda

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for VAMP-1 Antibody (5F3) - Azide and BSA Free

Western Blot: VAMP-1 Antibody (5F3) [H00006843-M01]

Western Blot: VAMP-1 Antibody (5F3) [H00006843-M01]

Western Blot: VAMP-1 Antibody (5F3) [H00006843-M01] - VAMP1 monoclonal antibody (M01), clone 5F3. Analysis of VAMP1 expression in HepG2.
Sandwich ELISA: VAMP-1 Antibody (5F3) [H00006843-M01] - Detection limit for recombinant GST tagged VAMP1 is approximately 0.1ng/ml as a capture antibody.

Applications for VAMP-1 Antibody (5F3) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: VAMP-1

Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. VAMP1 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Multiple alternative splice variants that encode proteins with alternative carboxy ends have been described, but the full-length nature of some variants has not been defined.

Long Name

Vesicle-Associated Membrane Protein 1

Alternate Names

SYB1, Synaptobrevin-1, VAMP1

Entrez Gene IDs

6843 (Human)

Gene Symbol

VAMP1

UniProt

NP_055046 (Human)

Additional VAMP-1 Products

Product Documents for VAMP-1 Antibody (5F3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VAMP-1 Antibody (5F3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VAMP-1 Antibody (5F3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review VAMP-1 Antibody (5F3) - Azide and BSA Free and earn rewards!

Have you used VAMP-1 Antibody (5F3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies