VAMP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83746

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all VAMP4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human VAMP4. Peptide sequence: RGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for VAMP4 Antibody - BSA Free

Western Blot: VAMP4 Antibody [NBP2-83746]

Western Blot: VAMP4 Antibody [NBP2-83746]

Western Blot: VAMP4 Antibody [NBP2-83746] - WB Suggested Anti-VAMP4 antibody Titration: 1 ug/mL. Sample Type: Human Fetal Liver

Applications for VAMP4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VAMP4

The vesicle associated membrane proteins (VAMP) or synaptobrevins are calcium binding proteins specific to eukaryotes. VAMPs, along with synaptosomal associated protein of 25 kDa (SNAP 25) and syntaxin, form the core complex of soluble NSF attachment protein receptor (SNARE) proteins that interact with the soluble proteins N-ethylmaleimide-sensitive factor (NSF) and alpha-SNAP. These membrane associated proteins play a key role in the regulation of vesicle membrane fusion with the plasma membrane. The Clostridium tetani neurotoxin is a metalloprotease with specificity for VAMP. In Alzheimer®s disease, VAMP levels of all isoforms appear to be significantly lowered.

Alternate Names

VAMP24, VAMP-4, vesicle-associated membrane protein 4

Gene Symbol

VAMP4

Additional VAMP4 Products

Product Documents for VAMP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VAMP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VAMP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VAMP4 Antibody - BSA Free and earn rewards!

Have you used VAMP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies