VAT1L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88568

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all VAT1L Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of VAT1L. Peptide sequence: FIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for VAT1L Antibody - BSA Free

Western Blot: VAT1L Antibody [NBP2-88568]

Western Blot: VAT1L Antibody [NBP2-88568]

Western Blot: VAT1L Antibody [NBP2-88568] - WB Suggested Anti-Vat1l Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Kidney
Western Blot: VAT1L Antibody [NBP2-88568]

Western Blot: VAT1L Antibody [NBP2-88568]

Western Blot: VAT1L Antibody [NBP2-88568] - WB Suggested Anti-Vat1l Antibody. Positive Control: Lane 1: 60ug human NT2 cell line Lane 2: 80ug mouse brain extract. Primary Antibody Dilution : 1:500. Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR Bioscience. Secondry Antibody Dilution

Applications for VAT1L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VAT1L

Alternate Names

KIAA1576synaptic vesicle membrane protein VAT-1 homolog-like, vesicle amine transport protein 1 homolog (T. californica)-like, vesicle amine transport protein 1 homolog-like (T. californica)

Gene Symbol

VAT1L

Additional VAT1L Products

Product Documents for VAT1L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VAT1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VAT1L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VAT1L Antibody - BSA Free and earn rewards!

Have you used VAT1L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies