VAV3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86891

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all VAV3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human VAV3. Peptide sequence: EIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for VAV3 Antibody - BSA Free

Western Blot: VAV3 Antibody [NBP2-86891]

Western Blot: VAV3 Antibody [NBP2-86891]

Western Blot: VAV3 Antibody [NBP2-86891] - Host: Rabbit. Target Name: VAV3. Sample Type: Fetal Lung. Antibody Dilution: 1.0ug/ml

Applications for VAV3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VAV3

The Vav family are Rho/Rac guanosine nucleotide exchange factors (GEFs), consisting of three members in mammalian cells (Vav, Vav2, Vav3) and one in nematodes (CelVav) (1). Vav3 is expressed in most hematopoietic cells and non-hematopoietic tissues except ovary and skeletal muscles. T-cell stimulated and tyrosine phosphorylated Vav3 acts as an exchange factor for GTP-binding proteins RhoA, RhoG, and Rac1 (2). Also, tyrosine phosphorylated Vav3 mediates RTK signalizing, specifically IR, IGFR, and EGFR-mediated signaling pathways. Vav3 has been linked to as a factor for cell morphology modulation and an inducer for cell transformation (3).

Alternate Names

FLJ40431, guanine nucleotide exchange factor VAV3, vav 3 guanine nucleotide exchange factor, vav 3 oncogene, VAV-3

Gene Symbol

VAV3

Additional VAV3 Products

Product Documents for VAV3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VAV3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VAV3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VAV3 Antibody - BSA Free and earn rewards!

Have you used VAV3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies