Vinculin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55796

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Vinculin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Vinculin Antibody - BSA Free

Western Blot: Vinculin Antibody [NBP2-55796]

Western Blot: Vinculin Antibody [NBP2-55796]

Western Blot: Vinculin Antibody [NBP2-55796] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: Vinculin Antibody [NBP2-55796]

Immunocytochemistry/ Immunofluorescence: Vinculin Antibody [NBP2-55796]

Immunocytochemistry/Immunofluorescence: Vinculin Antibody [NBP2-55796] - Staining of human cell line U-2 OS shows localization to focal adhesion sites. Antibody staining is shown in green.

Applications for Vinculin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Vinculin

Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. (provided by RefSeq)

Long Name

Metavinculin

Alternate Names

MVCL, VCL

Gene Symbol

VCL

Additional Vinculin Products

Product Documents for Vinculin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Vinculin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Vinculin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Vinculin Antibody - BSA Free and earn rewards!

Have you used Vinculin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Vinculin Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Do you have any 100 coda or bigger controls?

    A: I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies