VKORC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83750

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all VKORC1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of VKORC1. Peptide sequence: LHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for VKORC1 Antibody - BSA Free

Western Blot: VKORC1 Antibody [NBP2-83750]

Western Blot: VKORC1 Antibody [NBP2-83750]

Western Blot: VKORC1 Antibody [NBP2-83750] - WB Suggested Anti-VKORC1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain
Immunohistochemistry-Paraffin: VKORC1 Antibody [NBP2-83750]

Immunohistochemistry-Paraffin: VKORC1 Antibody [NBP2-83750]

Immunohistochemistry-Paraffin: VKORC1 Antibody [NBP2-83750] - Rabbit Anti-VKORC1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Other Working Concentrations: N/A. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X. Exposure Time: 0.5 - 2.0 sec

Applications for VKORC1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VKORC1

Vitamin K is essential for blood clotting but must be enzymatically activated. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. The product of this gene encodes the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is the product of this gene that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance. Two pseudogenes have been identified on chromosome 1 and the X chromosome. Two alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq]

Alternate Names

EC 1.1.4.1, EDTP308, FLJ00289, IMAGE3455200, MST576, phylloquinone epoxide reductase, vitamin K dependent clMST134, vitamin K epoxide reductase complex subunit 1, vitamin K epoxide reductase complex, subunit 1, Vitamin K1 2,3-epoxide reductase subunit 1, vitamin K1 epoxide reductase (warfarin-sensitive), VKCFD2, VKORMGC2694

Gene Symbol

VKORC1

Additional VKORC1 Products

Product Documents for VKORC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VKORC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VKORC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VKORC1 Antibody - BSA Free and earn rewards!

Have you used VKORC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies