VPREB3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09504

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all VPREB3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human VPREB3 (NP_037510). Peptide sequence TIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for VPREB3 Antibody - BSA Free

Western Blot: VPREB3 Antibody [NBP3-09504]

Western Blot: VPREB3 Antibody [NBP3-09504]

Western Blot: VPREB3 Antibody [NBP3-09504] - Western blot analysis of VPREB3 in HT1080 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for VPREB3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VPREB3

The VPREB3 gene product is the human homologue of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. The VPREB3 protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of VPREB3 is not known, but it may contribute to mu chain transport in pre-B cells.

Alternate Names

N27C7-2, pre-B lymphocyte 3,8HS20, pre-B lymphocyte gene 3, pre-B lymphocyte protein 3, Protein VPreB3

Gene Symbol

VPREB3

Additional VPREB3 Products

Product Documents for VPREB3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VPREB3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VPREB3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VPREB3 Antibody - BSA Free and earn rewards!

Have you used VPREB3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies