VPS26A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93897

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all VPS26A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 256-327 of human VPS26A (NP_004887.2). DPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VPS26A Antibody - Azide and BSA Free

VPS26A Antibody - Azide and BSA Free

Western Blot: VPS26A Antibody - Azide and BSA Free [NBP2-93897] -

Western Blot: VPS26A Antibody - Azide and BSA Free [NBP2-93897] - Western blot analysis of various lysates, using VPS26A antibody (A14265) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: VPS26A Antibody - Azide and BSA Free [NBP2-93897]

Immunocytochemistry/ Immunofluorescence: VPS26A Antibody - Azide and BSA Free [NBP2-93897]

Immunocytochemistry/Immunofluorescence: VPS26A Antibody [NBP2-93897] - Analysis of NIH-3T3 cells using VPS26A. Blue: DAPI for nuclear staining.

Applications for VPS26A Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: VPS26A

VPS26 belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex.

Alternate Names

FLJ12930, HB58, Hbeta58, hVPS26, PEP8A, vacuolar protein sorting 26 (yeast homolog), vacuolar protein sorting 26 homolog A (S. pombe), vacuolar protein sorting 26 homolog A (yeast), vacuolar protein sorting-associated protein 26A, Vesicle protein sorting 26A, VPS26vacuolar protein sorting 26 (yeast)

Gene Symbol

VPS26A

Additional VPS26A Products

Product Documents for VPS26A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VPS26A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VPS26A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review VPS26A Antibody - Azide and BSA Free and earn rewards!

Have you used VPS26A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies