VPS52 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57628

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all VPS52 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to VPS52 (vacuolar protein sorting 52 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of VPS52)(50ug). Peptide sequence RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for VPS52 Antibody - BSA Free

Western Blot: VPS52 Antibody [NBP1-57628]

Western Blot: VPS52 Antibody [NBP1-57628]

Western Blot: VPS52 Antibody [NBP1-57628] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for VPS52 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VPS52

This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.

Alternate Names

ARE1, dJ1033B10.5, DKFZp547I194, SAC2, SAC2 suppressor of actin mutations 2-like (yeast), SAC2 suppressor of actin mutations 2-like protein, SACM2LRP5-1033B10, vacuolar protein sorting 52 (yeast), vacuolar protein sorting 52 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 52 homolog

Gene Symbol

VPS52

UniProt

Q8N1B4 (Human)

Additional VPS52 Products

Product Documents for VPS52 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VPS52 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VPS52 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VPS52 Antibody - BSA Free and earn rewards!

Have you used VPS52 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies