VTA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57637

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all VTA1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to VTA1(Vps20-associated 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VTA1 (NP_057569). Peptide sequence KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for VTA1 Antibody - BSA Free

Western Blot: VTA1 Antibody [NBP1-57637]

Western Blot: VTA1 Antibody [NBP1-57637]

Western Blot: VTA1 Antibody [NBP1-57637] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Applications for VTA1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VTA1

C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).

Alternate Names

C6orf55DRG1, Dopamine-responsive gene 1 protein, DRG-1, FLJ27228, homolog of mouse SKD1-binding protein 1, LIP5HSPC228, LYST-interacting protein 5, My012, SBP1chromosome 6 open reading frame 55, SKD1-binding protein 1, vacuolar protein sorting-associated protein VTA1 homolog, Vps20-associated 1 homolog (S. cerevisiae)

Entrez Gene IDs

51534 (Human)

Gene Symbol

VTA1

UniProt

Q9NP79 (Human)

Additional VTA1 Products

Product Documents for VTA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VTA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for VTA1 Antibody - BSA Free

Customer Reviews for VTA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VTA1 Antibody - BSA Free and earn rewards!

Have you used VTA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies