WDR33 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60030

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to WDR33(WD repeat domain 33) The peptide sequence was selected from the middle region of WDR33. Peptide sequence TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for WDR33 Antibody - BSA Free

Western Blot: WDR33 Antibody [NBP1-60030]

Western Blot: WDR33 Antibody [NBP1-60030]

Western Blot: WDR33 Antibody [NBP1-60030] - Human HepG2, Antibody Dilution: 1.0 ug/ml WDR33 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: WDR33 Antibody [NBP1-60030]

Western Blot: WDR33 Antibody [NBP1-60030]

Western Blot: WDR33 Antibody [NBP1-60030] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: WDR33 Antibody [NBP1-60030]

Western Blot: WDR33 Antibody [NBP1-60030]

Western Blot: WDR33 Antibody [NBP1-60030] - Lanes: 1 : SREC pulldown from lysate from 10^6 human 293T cells Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-Alexa Fluor Secondary, Antibody Dilution: 1 : 5000 Gene name: WDR33.

Applications for WDR33 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR33

WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Alternate Names

NET14, WD repeat domain 33, WD repeat-containing protein 33, WD repeat-containing protein WDC146, WDC146FLJ11294

Gene Symbol

WDR33

UniProt

Additional WDR33 Products

Product Documents for WDR33 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR33 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR33 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR33 Antibody - BSA Free and earn rewards!

Have you used WDR33 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...