WDR9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54801

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WDR9 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to BRWD1(bromodomain and WD repeat domain containing 1) The peptide sequence was selected from the N terminal of BRWD1. Peptide sequence MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for WDR9 Antibody - BSA Free

Western Blot: WDR9 Antibody [NBP1-54801]

Western Blot: WDR9 Antibody [NBP1-54801]

Western Blot: WDR9 Antibody [NBP1-54801] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.

Applications for WDR9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR9

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

Alternate Names

bromodomain and WD repeat domain containing 1, bromodomain and WD repeat-containing protein 1, C21orf107, chromosome 21 open reading frame 107, FLJ11315, FLJ43918, N143, transcriptional unit N143, WD repeat domain 9, WD repeat protein WDR9-form2, WD repeat-containing protein 9, WDR9

Gene Symbol

BRWD1

UniProt

Q6P2D1 (Human)

Additional WDR9 Products

Product Documents for WDR9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WDR9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR9 Antibody - BSA Free and earn rewards!

Have you used WDR9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies