WFDC5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57932

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WFDC5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to WFDC5(WAP four-disulfide core domain 5) The peptide sequence was selected from the N terminal of WFDC5. Peptide sequence MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for WFDC5 Antibody - BSA Free

Western Blot: WFDC5 Antibody [NBP1-57932]

Western Blot: WFDC5 Antibody [NBP1-57932]

Western Blot: WFDC5 Antibody [NBP1-57932] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for WFDC5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WFDC5

WFDC5 is a putative acid-stable proteinase inhibitor.This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.

Alternate Names

dJ211D12.5, PRG5protease inhibitor WAP1, Putative protease inhibitor WAP1, WAP four-disulfide core domain 5, WAP four-disulfide core domain protein 5, WAP1p53-responsive gene 5 protein

Gene Symbol

WFDC5

Additional WFDC5 Products

Product Documents for WFDC5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WFDC5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WFDC5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WFDC5 Antibody - BSA Free and earn rewards!

Have you used WFDC5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies