WIPF1/WIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09961

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all WIPF1/WIP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WIPF1/WIP (NP_001070737.1). Peptide sequence PFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for WIPF1/WIP Antibody - BSA Free

Western Blot: WIPF1/WIP Antibody [NBP3-09961]

Western Blot: WIPF1/WIP Antibody [NBP3-09961]

Western Blot: WIPF1/WIP Antibody [NBP3-09961] - Western blot analysis of WIPF1/WIP in Human HCT116 Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for WIPF1/WIP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WIPF1/WIP

WIPF1 is involved in the organization of the actin cytoskeleton. The protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these WIPF1 and Wiskott-Aldrich syndrome protein may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. WIPF1 binds to Wiskott-Aldrich syndrome protein, profilin and actin. It is involved with NCK1 and GRB2 in the recruitment and activation of N-WASP and may be involved in regulating the subcellular localization of N-WASP, resulting in the disassembly of stress fibers in filopodia formation.

Alternate Names

WAS/WASL interacting protein family, member 1, WAS/WASL-interacting protein family member 1, WASP-interacting protein, WASPIP, WIPMGC111041, WiskProtein PRPL-2, WiskPRPL-2

Gene Symbol

WIPF1

Additional WIPF1/WIP Products

Product Documents for WIPF1/WIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WIPF1/WIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WIPF1/WIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WIPF1/WIP Antibody - BSA Free and earn rewards!

Have you used WIPF1/WIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies