XAGE1D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86898

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all XAGE1D Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of XAGE1D. Peptide sequence: QCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for XAGE1D Antibody - BSA Free

Western Blot: XAGE1D Antibody [NBP2-86898]

Western Blot: XAGE1D Antibody [NBP2-86898]

Western Blot: XAGE1D Antibody [NBP2-86898] - WB Suggested Anti-XAGE1D Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

Applications for XAGE1D Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: XAGE1D

XAGE1 is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. XAGE1 is strongly expressed in Ewing's sarcoma, alveolar rhabdomyosarcoma and normal testis. XAGE1 contains a nuclear localization signal and shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. Alternative splicing of XAGE1 generates 3 transcript variants, and one of which includes 2 transcripts generated from alternate transcription initiation sites.

Alternate Names

cancer/testis associated protein, CT12.1C, CTP9, G antigen family D member 2, member 1c, X antigen family, member 1C, XAGE1

Gene Symbol

XAGE1D

Additional XAGE1D Products

Product Documents for XAGE1D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for XAGE1D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for XAGE1D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review XAGE1D Antibody - BSA Free and earn rewards!

Have you used XAGE1D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies