YAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38430

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This YAP1 antibody was developed against a recombinant protein corresponding to amino acids: PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (83%)

Specificity

Based on the immunogen sequence, the expected cross reactivity for this YAP1 antibody would be for isotype 2, 4, 8 and 9.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit YAP1 Antibody - BSA Free (NBP2-38430) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for YAP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430]

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430]

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430] - Staining of human liver shows no positivity in hepatocytes as expected, negative control, dilution: 1:50 - 1:200.
Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430]

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430]

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430] - Staining of human placenta shows nuclear positivity in decidual cells, dilution: 1:50 - 1:200.
Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430]

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430]

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430] - Staining of human breast shows strong cytoplasmic positivity in glandular cells, dilution: 1:50 - 1:200.
Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430]

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430]

Immunohistochemistry-Paraffin: YAP1 Antibody [NBP2-38430] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells, dilution: 1:50 - 1:200.

Applications for YAP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: YAP1

The transcriptional coactivator Yes-associated protein (YAP), also known as Yes-associated protein 1 (YAP1), Yes-Associated Protein YAP65 Homolog, Protein Yorkie Homolog and YAP65 has a theoretical molecular weight of 65 kDa. The YAP1 gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. YAP1 shares homology with the WW domain of transcriptional co-activator with PDZ-binding motif (TAZ), which functions as a transcriptional co-activator by binding to the PPXY motif present in transcription factors and is likely involved in protein-protein interaction. YAP has been identified as a core regulatory mechanism that blocks mammalian glial cell proliferation and cellular reprogramming following damage (1).

YAP plays a role in the development and progression of multiple cancers as a transcriptional regulator of the Hippo signaling pathway. YAP1 encodes a nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis to play a pivotal role in controlling cell growth and organ size and has emerged as a key player in tumor suppression (2,3). Deregulation of the Hippo pathway causes tumor formation and malignancy, with YAP being a key oncogenic driver in liver carcinogenesis (2) and may function as a potential target for cancer treatment (3).

References

1. Rueda, E. M., Hall, B. M., Hill, M. C., Swinton, P. G., Tong, X., Martin, J. F., & Poche, R. A. (2019). The Hippo Pathway Blocks Mammalian Retinal Muller Glial Cell Reprogramming. Cell Rep, 27(6), 1637-1649.e1636. doi:10.1016/j.celrep.2019.04.047

2. Liu, A. M., Xu, M. Z., Chen, J., Poon, R. T., & Luk, J. M. (2010). Targeting YAP and Hippo signaling pathway in liver cancer. Expert Opin Ther Targets, 14(8), 855-868. doi:10.1517/14728222.2010.499361

3.Ye, S., & Eisinger-Mathason, T. S. (2016). Targeting the Hippo pathway: Clinical implications and therapeutics. Pharmacol Res, 103, 270-278. doi:10.1016/j.phrs.2015.11.025

Long Name

Yes-associated Protein 1

Alternate Names

YAP2, YAP65, YKI, Yorkie Homolog

Gene Symbol

YAP1

UniProt

Additional YAP1 Products

Product Documents for YAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for YAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for YAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review YAP1 Antibody - BSA Free and earn rewards!

Have you used YAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...