YY1AP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88600

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all YY1AP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human YY1AP1. Peptide sequence: WTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for YY1AP1 Antibody - BSA Free

Western Blot: YY1AP1 Antibody [NBP2-88600]

Western Blot: YY1AP1 Antibody [NBP2-88600]

Western Blot: YY1AP1 Antibody [NBP2-88600] - WB Suggested Anti-YY1AP1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Hela cell lysateYY1AP1 is supported by BioGPS gene expression data to be expressed in HeLa

Applications for YY1AP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: YY1AP1

The encoded gene product presumably interacts with YY1 protein; however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding different isoforms. (provided by RefSeq)

Alternate Names

FLJ10875, FLJ13914, HCCA1, HCCA2YY1APYAP, Hepatocellular carcinoma susceptibility protein, Hepatocellular carcinoma-associated protein 2, YY1 associated protein 1, YY1-associated protein 1

Gene Symbol

YY1AP1

Additional YY1AP1 Products

Product Documents for YY1AP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for YY1AP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for YY1AP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review YY1AP1 Antibody - BSA Free and earn rewards!

Have you used YY1AP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies