ZCRB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10542

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZCRB1 (NP_149105). Peptide sequence MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZCRB1 Antibody - BSA Free

Western Blot: ZCRB1 Antibody [NBP3-10542]

Western Blot: ZCRB1 Antibody [NBP3-10542]

Western Blot: ZCRB1 Antibody [NBP3-10542] - Western blot analysis using NBP3-10542 on Human Spleen as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for ZCRB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZCRB1

Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognizes the 5' splice site and branch-point sequence. U11 and U12 snRNPs are components of U12-type spliceosome and function as a molecular bridge connecting both ends of the intron. The protein encoded by this gene contains a RNA recognition motif. It was identified as one of the protein components of U11/U12 snRNPs. This protein and many other U11/U12 snRNP proteins are highly conserved in organisms known to contain U12-type introns. These proteins have been shown to be essential for cell viability, suggesting the key roles in U12-type splicing. [provided by RefSeq]

Alternate Names

MADP-1, MADP1U11/U12 snRNP 31 kDa protein, MGC26805, RBM36, U11/U12 small nuclear ribonucleoprotein 31 kDa protein, U11/U12 snRNP 31K, U11/U12-31K, ZCCHC19, zinc finger CCHC-type and RNA binding motif 1, zinc finger CCHC-type and RNA-binding motif-containing protein 1

Gene Symbol

ZCRB1

Additional ZCRB1 Products

Product Documents for ZCRB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZCRB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZCRB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZCRB1 Antibody - BSA Free and earn rewards!

Have you used ZCRB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...