ZFX Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86421

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZFX. Peptide sequence: KVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNSSIRVPREKMVYM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZFX Antibody - BSA Free

Western Blot: ZFX Antibody [NBP2-86421]

Western Blot: ZFX Antibody [NBP2-86421]

Western Blot: ZFX Antibody [NBP2-86421] - Host: Rabbit. Target Name: ZFX. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421]

Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421]

Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421] - Rabbit Anti-ZFX Antibody. Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421]

Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421]

Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421] - Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE).. Antibody Concentration: 10 ug/ml.
Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421]

Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421]

Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421] - Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE).. Antibody Concentration: 10 ug/ml.

Applications for ZFX Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZFX

ZFX, also known as Zinc finger X-chromosomal protein, is a 91kDa 805 amino acid protein with a shorter 66kDa 576 isoform. The gene can be found in the nucleus where it encodes a member of the krueppel C2H2-type zinc-finger protein family. Current research is being conducted on ZFX in relation to the diseases azoospermia, prostate adenocarcinoma, premature ovarian failure and adenocarcinoma. ZFX is linked to the dosage compensation, sex determination, spermatogenesis, meiosis, cell cycle and fertilization.

Alternate Names

zinc finger protein, X-linked

Gene Symbol

ZFX

Additional ZFX Products

Product Documents for ZFX Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZFX Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZFX Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZFX Antibody - BSA Free and earn rewards!

Have you used ZFX Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...