ZFYVE1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79427

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZFYVE1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human ZFYVE1The immunogen for this antibody is ZFYVE1. Peptide sequence VCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

87 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ZFYVE1 Antibody - BSA Free

Western Blot: ZFYVE1 Antibody [NBP1-79427]

Western Blot: ZFYVE1 Antibody [NBP1-79427]

Western Blot: ZFYVE1 Antibody [NBP1-79427] - 293T cells lysate, concentration 0.2-1 ug/ml.

Applications for ZFYVE1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZFYVE1

The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains two zinc-binding FYVE domains in tandem. This protein displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes. [provided by RefSeq]

Alternate Names

DFCP1, DFCP1phosphoinositide-binding protein SR3, Double FYVE-containing protein 1, KIAA1589tandem FYVE fingers-1 protein, SR3, TAFF1zinc finger FYVE domain-containing protein 1, Tandem FYVE fingers-1, zinc finger protein, subfamily 2A (FYVE domain containing), 1, zinc finger, FYVE domain containing 1, ZNFN2A1zinc finger protein, subfamily 2A, member 1

Gene Symbol

ZFYVE1

UniProt

NP_067083 (Human)

Additional ZFYVE1 Products

Product Documents for ZFYVE1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZFYVE1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZFYVE1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZFYVE1 Antibody - BSA Free and earn rewards!

Have you used ZFYVE1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies