ZHX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10465

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZHX2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse ZHX2 (NP_955520). Peptide sequence RGRDAVSRKVAKQVAESPKNGSEAAHQYAKDPKALSEEDSEKLVPRMKVG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZHX2 Antibody - BSA Free

Western Blot: ZHX2 Antibody [NBP3-10465]

Western Blot: ZHX2 Antibody [NBP3-10465]

Western Blot: ZHX2 Antibody [NBP3-10465] - Western blot analysis of ZHX2 in Mouse Heart lysates. Antibody dilution at 1.0ug/ml

Applications for ZHX2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZHX2

The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 2 of this gene family. In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.

Alternate Names

Zona pellucida glycoprotein 2, zona pellucida glycoprotein 2 (sperm receptor), zona pellucida glycoprotein ZP2, Zona pellucida protein A, zona pellucida sperm-binding protein 2, Zp-2, ZPA

Gene Symbol

ZHX2

Additional ZHX2 Products

Product Documents for ZHX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZHX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZHX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZHX2 Antibody - BSA Free and earn rewards!

Have you used ZHX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies