ZIC1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94229

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ZIC1 (NP_003403.2). LFAASAGGFGGPHGHTDAAGHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZIC1 Antibody - Azide and BSA Free

Western Blot: ZIC1 AntibodyAzide and BSA Free [NBP2-94229]

Western Blot: ZIC1 AntibodyAzide and BSA Free [NBP2-94229]

Western Blot: ZIC1 Antibody [NBP2-94229] - Analysis of extracts of various cell lines, using ZIC1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for ZIC1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZIC1

The Zic-1 gene, which encodes a zinc finger protein, is expressed in the developing or matured central nervous system in a highly restricted manner. The Zic gene is expressed in granule cells that make synaptic contact with Purkinje cells. Clearly Zic-1 is a gene critical to cerebellar pattern formation. The expression of Zic genes is first detected at gastrulation and at neurulation, becomes restricted to the dorsal neural ectoderm and the dorsal paraxial mesoderm. Zic-2 and Zic-3 are highly similar genes, especially in their product's zinc finger motif and by comparison of their genomic organization in that they share common exon-intron boundaries and belong to the same gene family. By comparison in function, Zic-2 is essential for the formation of the brain and Zic-3 is important for right and left axis formation. The Zic-1 gene has been mapped to chromosome 9 in mouse. The 5' flanking region of the Zic-1 gene contains a region-specific enhancer determined to be essential in in vivo and in vitro deletion analysis. The temporal profile of mRNA expression differs for each of the Zic gene products. The Drosophila odd-paired gene is highly homologous to the Zic gene family.

Long Name

Zic Family Member 1

Alternate Names

ZNF201

Gene Symbol

ZIC1

Additional ZIC1 Products

Product Documents for ZIC1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZIC1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ZIC1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ZIC1 Antibody - Azide and BSA Free and earn rewards!

Have you used ZIC1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...