Zinc finger protein 180 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88631

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Zinc finger protein 180 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Zinc finger protein 180. Peptide sequence: LHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSHS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Zinc finger protein 180 Antibody - BSA Free

Western Blot: Zinc finger protein 180 Antibody [NBP2-88631]

Western Blot: Zinc finger protein 180 Antibody [NBP2-88631]

Western Blot: Zinc finger protein 180 Antibody [NBP2-88631] - WB Suggested Anti-ZNF180 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: 293T cell lysateZNF180 is supported by BioGPS gene expression data to be expressed in HEK293T

Applications for Zinc finger protein 180 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Zinc finger protein 180

Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See MIM 604749 for additional information on zinc finger proteins.[supplied by OMIM]

Alternate Names

HHZ168zinc finger protein 180 (HHZ168), zinc finger protein 180

Gene Symbol

ZNF180

Additional Zinc finger protein 180 Products

Product Documents for Zinc finger protein 180 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Zinc finger protein 180 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Zinc finger protein 180 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Zinc finger protein 180 Antibody - BSA Free and earn rewards!

Have you used Zinc finger protein 180 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies