Zinc finger protein 395 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10968

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Zinc finger protein 395 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Zinc finger protein 395 (NP_061130). Peptide sequence SGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Zinc finger protein 395 Antibody - BSA Free

Western Blot: Zinc finger protein 395 Antibody [NBP3-10968]

Western Blot: Zinc finger protein 395 Antibody [NBP3-10968]

Western Blot: Zinc finger protein 395 Antibody [NBP3-10968] - Western blot analysis using NBP3-10968 on Transfected 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for Zinc finger protein 395 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Zinc finger protein 395

Papillomavirus Regulatory Factor 1/HDBP2 is a novel transcription factor shuttling between nucleus and cytoplasm and binds to the specific GCCGGCG, which is an essential cis-element for Huntington's disease gene expression.

Alternate Names

dJ874C20.2, FLJ23407, zinc finger protein 310 pseudogene, zinc finger protein 323, ZNF20-Lp, ZNF310P

Gene Symbol

ZNF395

Additional Zinc finger protein 395 Products

Product Documents for Zinc finger protein 395 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Zinc finger protein 395 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Zinc finger protein 395 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Zinc finger protein 395 Antibody - BSA Free and earn rewards!

Have you used Zinc finger protein 395 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies