Zinc finger protein 682 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83807

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Zinc finger protein 682 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Zinc finger protein 682. Peptide sequence: KGFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSELRQHSCSSSG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Zinc finger protein 682 Antibody - BSA Free

Western Blot: Zinc finger protein 682 Antibody [NBP2-83807]

Western Blot: Zinc finger protein 682 Antibody [NBP2-83807]

Western Blot: Zinc finger protein 682 Antibody [NBP2-83807] - WB Suggested Anti-ZNF682 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human Lung

Applications for Zinc finger protein 682 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Zinc finger protein 682

ZNF682, also known as Zinc finger protein 682, has an 498 amino acid long isoform that is 58 kDa, a 466 amino acid isoform that is 54 kDa, and a shorter third 422 amino acid isoform that is 49 kDa, and might be involved in transcriptional regulation. This process occurs in the generic transcription pathway.

Alternate Names

BC39498_3, FLJ90362, zinc finger protein 682

Gene Symbol

ZNF682

Additional Zinc finger protein 682 Products

Product Documents for Zinc finger protein 682 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Zinc finger protein 682 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Zinc finger protein 682 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Zinc finger protein 682 Antibody - BSA Free and earn rewards!

Have you used Zinc finger protein 682 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies