ZNF18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09244

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF18 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse ZNF18 (NP_080383). Peptide sequence FSGLRHHEKIHTGEKPYKCPLCEKSFIQRSNFNRHQRVHTGEKPYKCTHC

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZNF18 Antibody - BSA Free

Western Blot: ZNF18 Antibody [NBP3-09244]

Western Blot: ZNF18 Antibody [NBP3-09244]

Western Blot: ZNF18 Antibody [NBP3-09244] - Western blot analysis of ZNF18 in Mouse Stomach lysates. Antibody dilution at 1.0ug/ml

Applications for ZNF18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF18

ZNF18 may be involved in transcriptional regulation.

Alternate Names

HDSG1Zinc finger protein 535, heart development-specific protein, KOX11Heart development-specific gene 1 protein, Zfp535, zinc finger protein 18, zinc finger protein 18 (KOX 11), ZKSCAN6Zinc finger protein KOX11, ZNF535Zinc finger protein with KRAB and SCAN domains 6

Gene Symbol

ZNF18

Additional ZNF18 Products

Product Documents for ZNF18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF18 Antibody - BSA Free and earn rewards!

Have you used ZNF18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies