ZNF254 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80111

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZNF254 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human ZNF254. Peptide sequence SKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ZNF254 Antibody - BSA Free

Western Blot: ZNF254 Antibody [NBP1-80111]

Western Blot: ZNF254 Antibody [NBP1-80111]

Western Blot: ZNF254 Antibody [NBP1-80111] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for ZNF254 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF254

Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.(supplied by OMIM)

Alternate Names

BA526D8.4, FLJ33884, KRAB box containing C2H2 type zinc finger bA526D8.4, MGC133033, MGC133034, zinc finger protein 484

Gene Symbol

ZNF254

Additional ZNF254 Products

Product Documents for ZNF254 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNF254 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF254 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF254 Antibody - BSA Free and earn rewards!

Have you used ZNF254 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies