ZNF312 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84355

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF312 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF312. Peptide sequence: THNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZNF312 Antibody - BSA Free

Western Blot: ZNF312 Antibody [NBP2-84355]

Western Blot: ZNF312 Antibody [NBP2-84355]

Western Blot: ZNF312 Antibody [NBP2-84355] - WB Suggested Anti-ZNF312 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysateFEZF2 is supported by BioGPS gene expression data to be expressed in HepG2

Applications for ZNF312 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF312

Transcription repressor. Required for the specification of corticospinal motor neurons and other subcerebral projection neurons. May play a role in layer and neuronal subtype-specific patterning of subcortical projections and axonal fasciculation. Controls the development of dendritic arborization and spines of large layer V pyramidal neurons. May be involved in innate immunity

Alternate Names

FEZ family zinc finger 2, fez family zinc finger protein 2, FEZLFEZ, FKSG36, FLJ10142, Forebrain embryonic zinc finger-like protein 2, Zfp312, Zinc finger protein 312TOFZNF312ZFP312, Zinc finger protein Fez-like

Gene Symbol

FEZF2

Additional ZNF312 Products

Product Documents for ZNF312 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF312 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF312 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF312 Antibody - BSA Free and earn rewards!

Have you used ZNF312 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies